Loading...
Statistics
Advertisement

g-and-g
www.gandgexpress.com/

Gandgexpress.com

Advertisement
Conversion Technology Metas Server
Gandgexpress.com is hosted in United States / Ashburn . Gandgexpress.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Html5, Number of used javascripts: 2. First javascripts: Require.min.js, Main-r.min.js, Number of used analytics tools: 0. Its server type is: Pepyaka/1.9.13. Its CMS is: Wix.

Technologies in use by Gandgexpress.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Html5
  • Javascript

Advertisement

Javascripts

Number of occurences: 2
  • require.min.js
  • main-r.min.js

Content Management System

Number of occurences: 1
  • Wix

Server Type

  • Pepyaka/1.9.13

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Gandgexpress.com

Missing HTTPS protocol.

    Meta - Gandgexpress.com

    Number of occurences: 5
    • Name:
      Content: g-and-g
    • Name: fb_admins_meta_tag
      Content:
    • Name: SKYPE_TOOLBAR
      Content: SKYPE_TOOLBAR_PARSER_COMPATIBLE
    • Name: viewport
      Content: minimum-scale=0.25, maximum-scale=1.2
    • Name: fragment
      Content: !

    Server / Hosting

    • IP: 52.207.18.242
    • Latitude: 39.05
    • Longitude: -77.47
    • Country: United States
    • City: Ashburn

    Rname

    • ns1.wixdns.net
    • ns0.wixdns.net
    • smtp.secureserver.net
    • mailstore1.secureserver.net

    Target

    • support.wix.com

    HTTP Header Response

    HTTP/1.1 200 OK Cache-Control: max-age=0, must-revalidate Cache-Control: no-cache Content-Language: en Content-Type: text/html;charset=UTF-8 Date: Sat, 06 Aug 2016 22:22:45 GMT ETag: c538dfc77b4d0ce17c1b9ed1452d679d Expires: Thu, 01 Jan 1970 00:00:00 GMT Pragma: no-cache Pragma: no-cache Server: Pepyaka/1.9.13 Set-Cookie: hs=275742989;Path=/;Domain=www.gandgexpress.com;HttpOnly Set-Cookie: svSession=f8392c2365c5222d7051bf47718a6f09e98e401979d0923618fc78daa10199aefcf70c3ee9bcdd322d4d34a1b700e5761e60994d53964e647acf431e4f798bcd720d86bc7670bfa22cf4e866965a08ccb159870bb3676abe68f916e37145ba8f;Path=/;Domain=www.gandgexpress.com;Expires=Fri, 06-Aug-2021 22:22:44 GMT Set-Cookie: _wixAB3=16609#1;Path=/;Domain=.wix.com;Expires=Sat, 04-Feb-2017 22:22:45 GMT Vary: User-Agent X-Seen-By: ZobbenBcJCujcSB2vhdoP6zhGl4kqOrRB2lgJXJWOaEVg8yBNrCddpK11/FwIFN7,Tw2AanFDQ+Wwo8Xxk6ZL7rHKeAJXtkPxqn+uc4aMlODYwLQTQ3vCVaPibyQ2Qn8inUoPRWylvzmW1WtoYIgS/A==,LwsIp90Tma5sliyMxJYVEvTqUnkRwR430ALk+UZyw7PnaXGSE7xQP0F5eUkr7UI2,9/zAiwmuIQ5G9xgIqi9IpfKjiM3HhjsT5sK9PwlANII= X-Wix-Renderer-Server: app202.vae.aws X-Wix-Request-Id: 1470522165.52527657736911632280 Content-Length: 14337 X-Cache: MISS from s_hh40 X-Cache-Lookup: MISS from s_hh40:80 Via: 1.1 s_hh40 (squid/3.5.11) Connection: keep-alive

    DNS

    host: gandgexpress.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 23.236.62.147
    host: gandgexpress.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.wixdns.net
    host: gandgexpress.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns0.wixdns.net
    host: gandgexpress.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns0.wixdns.net
    5. rname: support.wix.com
    6. serial: 2015050521
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: gandgexpress.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net
    host: gandgexpress.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.andgexpress.com, www.gsandgexpress.com, www.sandgexpress.com, www.gxandgexpress.com, www.xandgexpress.com, www.gyandgexpress.com, www.yandgexpress.com, www.ghandgexpress.com, www.handgexpress.com, www.gnandgexpress.com, www.nandgexpress.com, www.gcandgexpress.com, www.candgexpress.com, www.gdandgexpress.com, www.dandgexpress.com, www.geandgexpress.com, www.eandgexpress.com, www.grandgexpress.com, www.randgexpress.com, www.gtandgexpress.com, www.tandgexpress.com, www.gbandgexpress.com, www.bandgexpress.com, www.gvandgexpress.com, www.vandgexpress.com, www.gndgexpress.com, www.gaondgexpress.com, www.gondgexpress.com, www.gapndgexpress.com, www.gpndgexpress.com, www.ga9ndgexpress.com, www.g9ndgexpress.com, www.gandgexpress.com, www.gndgexpress.com, www.gaindgexpress.com, www.gindgexpress.com, www.gaundgexpress.com, www.gundgexpress.com, www.gadgexpress.com, www.ganndgexpress.com, www.gandgexpress.com, www.ganhdgexpress.com, www.gahdgexpress.com, www.ganjdgexpress.com, www.gajdgexpress.com, www.gankdgexpress.com, www.gakdgexpress.com, www.ganldgexpress.com, www.galdgexpress.com, www.gan dgexpress.com, www.ga dgexpress.com, www.gangexpress.com, www.gandtgexpress.com, www.gantgexpress.com, www.gandggexpress.com, www.ganggexpress.com, www.gandbgexpress.com, www.ganbgexpress.com, www.gandxgexpress.com, www.ganxgexpress.com, www.gandsgexpress.com, www.gansgexpress.com, www.gandfgexpress.com, www.ganfgexpress.com, www.gandvgexpress.com, www.ganvgexpress.com, www.gandygexpress.com, www.ganygexpress.com, www.gandzgexpress.com, www.ganzgexpress.com, www.gandagexpress.com, www.ganagexpress.com, www.gandegexpress.com, www.ganegexpress.com, www.gandrgexpress.com, www.ganrgexpress.com, www.gandexpress.com, www.gandgxexpress.com, www.gandxexpress.com, www.gandgyexpress.com, www.gandyexpress.com, www.gandghexpress.com, www.gandhexpress.com, www.gandgnexpress.com, www.gandnexpress.com, www.gandgcexpress.com, www.gandcexpress.com, www.gandgdexpress.com, www.ganddexpress.com, www.gandgeexpress.com, www.gandeexpress.com, www.gandgrexpress.com, www.gandrexpress.com, www.gandgtexpress.com, www.gandtexpress.com, www.gandgbexpress.com, www.gandbexpress.com, www.gandgvexpress.com, www.gandvexpress.com, www.gandgxpress.com, www.gandgexxpress.com, www.gandgxxpress.com, www.gandgesxpress.com, www.gandgsxpress.com, www.gandgewxpress.com, www.gandgwxpress.com, www.gandgerxpress.com, www.gandgrxpress.com, www.gandgefxpress.com, www.gandgfxpress.com, www.gandgevxpress.com, www.gandgvxpress.com, www.gandgecxpress.com, www.gandgcxpress.com, www.gandgeqxpress.com, www.gandgqxpress.com, www.gandgeaxpress.com, www.gandgaxpress.com, www.gandgeyxpress.com, www.gandgyxpress.com, www.gandgepress.com, www.gandgexqpress.com, www.gandgeqpress.com, www.gandgexpress.com, www.gandgepress.com, www.gandgexapress.com, www.gandgeapress.com, www.gandgexspress.com, www.gandgespress.com, www.gandgexdpress.com, www.gandgedpress.com, www.gandgexepress.com, www.gandgeepress.com, www.gandgexress.com, www.gandgexpiress.com, www.gandgexiress.com, www.gandgexpkress.com, www.gandgexkress.com, www.gandgexpuress.com, www.gandgexuress.com, www.gandgexpjress.com, www.gandgexjress.com, www.gandgexplress.com, www.gandgexlress.com, www.gandgexpess.com, www.gandgexpriess.com, www.gandgexpiess.com, www.gandgexproess.com, www.gandgexpoess.com, www.gandgexprless.com, www.gandgexpless.com, www.gandgexprless.com, www.gandgexpless.com, www.gandgexpr.ess.com, www.gandgexp.ess.com, www.gandgexprss.com, www.gandgexprexss.com, www.gandgexprxss.com, www.gandgexpresss.com, www.gandgexprsss.com, www.gandgexprewss.com, www.gandgexprwss.com, www.gandgexprerss.com, www.gandgexprrss.com, www.gandgexprefss.com, www.gandgexprfss.com, www.gandgexprevss.com, www.gandgexprvss.com, www.gandgexprecss.com, www.gandgexprcss.com, www.gandgexpreqss.com, www.gandgexprqss.com, www.gandgexpreass.com, www.gandgexprass.com, www.gandgexpreyss.com, www.gandgexpryss.com,

    Other websites we recently analyzed

    1. wesvirginfatdiminishersystem.com
      Ashburn (United States) - 54.243.49.127
      Server software: Apache/2.2.22 (Debian) mod_qos/10.8
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 3
    2. WAYCO Equipment Ltd
      Wayco Equipment distributes automotive workshop equipment. Brands include Wayco, Rokit Air and KC Tools
      Australia - 202.124.241.203
      Server software: LiteSpeed
      Technology: Html
      Number of Javascript: 2
      Number of meta tags: 5
    3. Tax Sentinel
      San Francisco (United States) - 192.241.207.240
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: BootstrapCDN, Maxcdn, CSS, Flexslider, Font Awesome, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Wordpress
      Number of Javascript: 17
      Number of meta tags: 3
    4. Personal Injury Attorneys - Accident Lawyers
      If you have been seriously hurt, please contact our skilled personal injury attorneys.
      Herndon (United States) - 64.34.165.173
      G Analytics ID: UA-23139809-4
      Server software: Apache/2.2.22 (Unix) mod_ssl/2.2.22 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 PHP/5.3.14
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 6
    5. Home - Back2Wood
      Germany - 85.13.144.74
      Server software: Apache
      Technology: CSS, Html, Html5, jQuery Colorbox, jQuery UI, MediaElement, Php, Swf Object
      Number of Javascript: 6
      Number of meta tags: 6
    6. nationalapartmentsource.net
      Houston (United States) - 192.254.250.178
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 2
    7. gannalyzer.net
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    8. TAG Solutions Home - TAG Solutions
      Chicago (United States) - 209.188.95.228
      G Analytics ID: UA-58783198-1
      Server software: Apache
      Technology: CSS, Font Awesome, Gravatar, Html, Javascript, jQuery, Php, Pingback, Google Analytics, WordPress Stats, Wordpress
      Number of Javascript: 19
      Number of meta tags: 3
    9. stantonwholesale.com
      Los Angeles (United States) - 208.73.210.100
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    10. John Paul II Center: Special Education in Shillington, PA
      John Paul II Center, a school for special education in Shillington, PA provides opportunities to children with intellectual and developmental disabilities.
      Cambridge (United States) - 208.94.36.109
      G Analytics ID: UA-53861797-1
      Server software: Microsoft-IIS/8.5
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Validate, MediaElement, Php, Pingback, Revslider, SVG, Google Analytics, WordPress Stats, Wordpress
      Number of Javascript: 34
      Number of meta tags: 6

    Check Other Websites